PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00021.148
Common NameAMTR_s00021p00187850
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family LBD
Protein Properties Length: 189aa    MW: 20855.5 Da    PI: 7.4622
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00021.148genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260112.23.5e-3510108198
                                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeee.redamsslvyeAear 68 
                                               aCaaCk++rrkC+++C lap fpae+  kf++vhk+FG+snv+kl+k+l++ee +++a++s+++eAe+r
  evm_27.model.AmTr_v1.0_scaffold00021.148  10 ACAACKHQRRKCTPECLLAPFFPAEHGDKFKAVHKVFGVSNVVKLIKSLDNEEkQTRAIESICWEAEWR 78 
                                               7************************************************76664899************ PP

                                    DUF260  69 ardPvyGavgvilklqqqleqlkaelallk 98 
                                               + +Pv+G+ + +++l+++l++l+ ela+++
  evm_27.model.AmTr_v1.0_scaffold00021.148  79 QLEPVEGCWAEFKRLNEELHRLRRELAEIH 108
                                               **************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.0939111IPR004883Lateral organ boundaries, LOB
PfamPF031959.9E-3510107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MLKGSSGHQA CAACKHQRRK CTPECLLAPF FPAEHGDKFK AVHKVFGVSN VVKLIKSLDN  60
EEKQTRAIES ICWEAEWRQL EPVEGCWAEF KRLNEELHRL RRELAEIHMC AKVYCAKNAL  120
PHGSCNNNNN NNNHNNSGNG HSCESCMGPT IGGAGTYGLI GLEGGSEGGD HVTPCPPAPP  180
SLNQHYYFQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006852542.21e-140PREDICTED: LOB domain-containing protein 2
TrEMBLW1Q0F61e-140W1Q0F6_AMBTC; Uncharacterized protein (Fragment)
STRINGSolyc12g010810.1.12e-31(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.11e-30LOB domain-containing protein 2
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]